DAO Antibody


Western Blot: DAO Antibody [NBP1-84304] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: DAO Antibody [NBP1-84304] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: DAO Antibody [NBP1-84304] - Staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.
Immunohistochemistry-Paraffin: DAO Antibody [NBP1-84304] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: DAO Antibody [NBP1-84304] - Staining in human kidney and lymph node tissues using anti-DAO antibody. Corresponding DAO RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DAO Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHE
Specificity of human DAO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DAO Protein (NBP1-84304PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DAO Antibody

  • DAAO
  • D-amino-acid oxidase
  • DAO
  • EC 1.4.3
  • EC
  • MGC35381


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Bv
Applications: WB, ELISA, IP
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DAO Antibody (NBP1-84304) (0)

There are no publications for DAO Antibody (NBP1-84304).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAO Antibody (NBP1-84304) (0)

There are no reviews for DAO Antibody (NBP1-84304). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAO Antibody (NBP1-84304) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DAO Products

Bioinformatics Tool for DAO Antibody (NBP1-84304)

Discover related pathways, diseases and genes to DAO Antibody (NBP1-84304). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAO Antibody (NBP1-84304)

Discover more about diseases related to DAO Antibody (NBP1-84304).

Pathways for DAO Antibody (NBP1-84304)

View related products by pathway.

PTMs for DAO Antibody (NBP1-84304)

Learn more about PTMs related to DAO Antibody (NBP1-84304).

Blogs on DAO

There are no specific blogs for DAO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DAO Antibody and receive a gift card or discount.


Gene Symbol DAO