DAGLA Antibody

Images

 
Immunohistochemistry-Paraffin: DAGLA Antibody [NBP2-31856] - Staining of human hippocampus shows moderate nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DAGLA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAGLA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DAGLA Protein (NBP2-31856PEP)
Publications
Read Publication using NBP2-31856.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DAGLA Antibody

  • C11orf11
  • DAGL(ALPHA)
  • DAGLALPHA
  • DGL-alpha
  • diacylglycerol lipase, alpha
  • EC 3.1.1.-
  • KIAA0659
  • Neural stem cell-derived dendrite regulator
  • NSDDRchromosome 11 open reading frame 11
  • sn1-specific diacylglycerol lipase alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
AF3410
Species: Hu
Applications: WB
NB300-872
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for DAGLA Antibody (NBP2-31856)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for DAGLA Antibody (NBP2-31856) (0)

There are no reviews for DAGLA Antibody (NBP2-31856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DAGLA Antibody (NBP2-31856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAGLA Products

DAGLA NBP2-31856

Bioinformatics Tool for DAGLA Antibody (NBP2-31856)

Discover related pathways, diseases and genes to DAGLA Antibody (NBP2-31856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAGLA Antibody (NBP2-31856)

Discover more about diseases related to DAGLA Antibody (NBP2-31856).

Research Areas for DAGLA Antibody (NBP2-31856)

Find related products by research area.

Blogs on DAGLA

There are no specific blogs for DAGLA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAGLA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAGLA
Uniprot