Cytokeratin 75 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KRT75 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cytokeratin 75 Antibody - BSA Free
Background
Keratin-75 is a protein that plays a central role in hair and nail formation, as it is an important component of the keratin intermediate filaments that are located in the companion layer of the hair follicle, and is 551 amino acids long with a weight of approximately 60 kDa. Studies are being conducted on diseases and disorders related to this protein including loose anagen hair syndrome, pseudofolliculitis barbae, histocytoma, Marek disease, dermatitis, alopecia, pharyngitis, lung cancer, breast cancer, esophagitis, hepatitis, and neuronitis. Keratin-75 has also been shown to have interactions with GABARAP, GABARAPL1, MAP1LC3A, MAR1LC3B, and AMBRA1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: PEP-ELISA, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Mu
Applications: WB
Publications for Cytokeratin 75 Antibody (NBP1-87845)(1)
Showing Publication 1 -
1 of 1.
| Publication using NBP1-87845 |
Applications |
Species |
| Claudia Mazio, Isabella Mavaro, Antonio Palladino, Costantino Casale, Francesco Urciuolo, Andrea Banfi, Livia D'Angelo, Paolo A. Netti, Paolo de Girolamo, Giorgia Imparato, Chiara Attanasio Rapid innervation and physiological epidermal regeneration by bioengineered dermis implanted in mouse Materials Today Bio 2024-01-10 [PMID: 38298559] |
|
|
Reviews for Cytokeratin 75 Antibody (NBP1-87845) (0)
There are no reviews for Cytokeratin 75 Antibody (NBP1-87845).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Cytokeratin 75 Antibody (NBP1-87845) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cytokeratin 75 Products
Blogs on Cytokeratin 75