Cytokeratin 20 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human liver shows no positivity in hepatocytes as expected

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Analysis in human small intestine tissue.

Immunohistochemistry analysis in human small intestine and liver tissues using HPA024309 antibody. Corresponding KRT20 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytokeratin 20 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytokeratin 20 Antibody - BSA Free (NBP1-85599) is a polyclonal antibody validated for use in IHC and WB. Anti-Cytokeratin 20 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 -1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Cytokeratin 20 Protein (NBP1-85599PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30522949).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytokeratin 20 Antibody - BSA Free

• CD20
• CK20
• CK-20
• Cytokeratin-20
• K20cytokeratin 20
• keratin 20
• keratin, type I cytoskeletal 20
• keratin-20
• KRT21
• MGC35423
• Protein IT

Background

Intermediate-sized filament (IF) protein designated cytokeratin (CK) 1 is a major cellular protein of mature enterocytes and goblet cells commonly found in mucosal epithelium of the mammalian gastrointestinal tract (1). Results strongly suggest that transcriptional regulation of keratin genes in the intestinal epithelium occurs at the level of both immature and terminally differentiated epithelial cells, and is tightly regulated during both fetal development and crypt-to-villus differentiation of the intestinal epithelium (2). CK20 has recently been reported to be useful to distinguish between primary and metastatic lung adenocarcinoma. CK20 expression was significantly more prevalent in adenocarcinoma that originated in the GI tract than that of pulmonary or breast origin (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytokeratin 20 Antibody (NBP1-85599)(2)

Publications using NBP1-85599

• Zhang R, Zhang X, Zhang W et al. Sohlh2 regulates the stemness and differentiation of colon cancer stem cells by downregulating LncRNA-H19 transcription Molecular cancer research : MCR 2022-10-26 [PMID: 36287177] (WB, Human)
• Steele N, Chakrabarti J, Wang J et al. An Organoid-Based Preclinical Model of Human Gastric Cancer Cellular and Molecular Gastroenterology and Hepatology 2018-09-02 [PMID: 30522949] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: KRT20
• Entrez:
  • 54474(Human)
• Uniprot:
  • P35900(Human)