Cytokeratin 20 Antibody


Western Blot: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine and liver tissues. Corresponding KRT20 RNA-seq data are presented for the same more
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human liver shows no positivity in hepatocytes as expected
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Cytokeratin 20 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
Specificity of human Cytokeratin 20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Cytokeratin 20 Protein (NBP1-85599PEP)
Read Publication using
NBP1-85599 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30522949).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cytokeratin 20 Antibody

  • CD20
  • CK20
  • CK-20
  • cytokeratin-20
  • K20cytokeratin 20
  • keratin 20
  • keratin, type I cytoskeletal 20
  • keratin-20
  • KRT21
  • MGC35423
  • Protein IT


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, Simple Western, Flow, AgAct, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Cytokeratin 20 Antibody (NBP1-85599)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Cytokeratin 20 Antibody (NBP1-85599) (0)

There are no reviews for Cytokeratin 20 Antibody (NBP1-85599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 20 Antibody (NBP1-85599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Cytokeratin 20 Products

Bioinformatics Tool for Cytokeratin 20 Antibody (NBP1-85599)

Discover related pathways, diseases and genes to Cytokeratin 20 Antibody (NBP1-85599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 20 Antibody (NBP1-85599)

Discover more about diseases related to Cytokeratin 20 Antibody (NBP1-85599).

Pathways for Cytokeratin 20 Antibody (NBP1-85599)

View related products by pathway.

PTMs for Cytokeratin 20 Antibody (NBP1-85599)

Learn more about PTMs related to Cytokeratin 20 Antibody (NBP1-85599).

Research Areas for Cytokeratin 20 Antibody (NBP1-85599)

Find related products by research area.

Blogs on Cytokeratin 20

There are no specific blogs for Cytokeratin 20, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytokeratin 20 Antibody and receive a gift card or discount.


Gene Symbol KRT20