Cytokeratin 20 Antibody

Images

 
Western Blot: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytokeratin 20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Cytokeratin 20 Protein (NBP1-85599PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytokeratin 20 Antibody

  • CD20
  • CK20
  • CK-20
  • cytokeratin-20
  • K20cytokeratin 20
  • keratin 20
  • keratin, type I cytoskeletal 20
  • keratin-20
  • KRT21
  • MGC35423
  • Protein IT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
NBP1-85599
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cytokeratin 20 Antibody (NBP1-85599) (0)

There are no publications for Cytokeratin 20 Antibody (NBP1-85599).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 20 Antibody (NBP1-85599) (0)

There are no reviews for Cytokeratin 20 Antibody (NBP1-85599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 20 Antibody (NBP1-85599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 20 Products

Bioinformatics Tool for Cytokeratin 20 Antibody (NBP1-85599)

Discover related pathways, diseases and genes to Cytokeratin 20 Antibody (NBP1-85599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 20 Antibody (NBP1-85599)

Discover more about diseases related to Cytokeratin 20 Antibody (NBP1-85599).
 

Pathways for Cytokeratin 20 Antibody (NBP1-85599)

View related products by pathway.

PTMs for Cytokeratin 20 Antibody (NBP1-85599)

Learn more about PTMs related to Cytokeratin 20 Antibody (NBP1-85599).
 

Research Areas for Cytokeratin 20 Antibody (NBP1-85599)

Find related products by research area.

Blogs on Cytokeratin 20

There are no specific blogs for Cytokeratin 20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT20
Entrez
Uniprot