Cytokeratin 19 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining in human urinary bladder and lymph node tissues . Corresponding KRT19 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Cytokeratin 19 Antibody [NBP1-85601] - Immunofluorescent staining of human cell line MCF7 shows localization to intermediate filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human urinary bladder shows strong cytoplasmic/membranous positivity in urothelial cells.

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human breast shows moderate cytoplasmic/membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human lymph node shows no positivity as expected.

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human small intestine shows moderate cytoplasmic/membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytokeratin 19 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytokeratin 19 Antibody - BSA Free (NBP1-85601) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
• Marker: Epithelial Cell Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cytokeratin 19 Recombinant Protein Antigen (NBP1-85601PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytokeratin 19 Antibody - BSA Free

• 40-kDa keratin intermediate filament
• CK19
• CK-19
• Cytokeratin 19
• EndoC
• K19
• K1CS
• keratin 19
• keratin, type I cytoskeletal 19
• keratin, type I, 40-kd
• keratin-19
• Krt19
• MGC15366

Background

Cytokeratin 19 (also known as Keratin, type I cytoskeletal 19) belongs to the keratin family which consists of fibrous proteins that make up the framework of epithelial cells. Cytokeratin 19 plays a role in the organization of myofibers. This protein is known to have interactions with ZNF638, FANCG, FAM107A, KRT15 and EXOC8. Cytokeratin 19 has been studied in relation to several disorders and diseases including chordoma, adenoma, hamartoma, adenoiditis, carcinoma, and liver disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT19