Cytokeratin 19 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cytokeratin 19 Antibody [NBP1-85601] - Immunofluorescent staining of human cell line MCF7 shows localization to intermediate filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human urinary bladder shows strong cytoplasmic/membranous positivity in urothelial cells.
Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human breast shows moderate cytoplasmic/membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human lymph node shows no positivity as expected.
Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining of human small intestine shows moderate cytoplasmic/membranous positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-85601] - Staining in human urinary bladder and lymph node tissues. Corresponding KRT19 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Cytokeratin 19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Marker
Epithelial Cell Marker
Specificity
Specificity of human Cytokeratin 19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cytokeratin 19 Protein (NBP1-85601PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytokeratin 19 Antibody

  • CK19
  • CK-19
  • Cytokeratin 19
  • Cytokeratin-19,40-kDa keratin intermediate filament
  • EndoC
  • K19
  • K19cytokeratin-19
  • K1CS
  • keratin 19
  • keratin, type I cytoskeletal 19
  • keratin, type I, 40-kd
  • keratin-19
  • Krt19
  • MGC15366

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60046
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97715
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Rb, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, CyTOF-ready
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for Cytokeratin 19 Antibody (NBP1-85601) (0)

There are no publications for Cytokeratin 19 Antibody (NBP1-85601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 19 Antibody (NBP1-85601) (0)

There are no reviews for Cytokeratin 19 Antibody (NBP1-85601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cytokeratin 19 Antibody (NBP1-85601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 19 Products

Bioinformatics Tool for Cytokeratin 19 Antibody (NBP1-85601)

Discover related pathways, diseases and genes to Cytokeratin 19 Antibody (NBP1-85601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 19 Antibody (NBP1-85601)

Discover more about diseases related to Cytokeratin 19 Antibody (NBP1-85601).
 

Pathways for Cytokeratin 19 Antibody (NBP1-85601)

View related products by pathway.

PTMs for Cytokeratin 19 Antibody (NBP1-85601)

Learn more about PTMs related to Cytokeratin 19 Antibody (NBP1-85601).
 

Research Areas for Cytokeratin 19 Antibody (NBP1-85601)

Find related products by research area.

Blogs on Cytokeratin 19

There are no specific blogs for Cytokeratin 19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT19
Entrez