Cytokeratin 15 Antibody


Orthogonal Strategies: Western Blot: Cytokeratin 15 Antibody [NBP1-85603] - Analysis in human cell lines A-431 and HEK293 using Anti-KRT15 antibody. Corresponding KRT15 RNA-seq data are presented for the same more
Immunocytochemistry/ Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human cell line HaCaT shows localization to intermediate filaments.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody [NBP1-85603] - Staining in human esophagus and stomach tissues using anti-KRT15 antibody. Corresponding KRT15 RNA-seq data are more
Western Blot: Cytokeratin 15 Antibody [NBP1-85603] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-143
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human stomach shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Cytokeratin 15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Specificity of human Cytokeratin 15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cytokeratin 15 Protein (NBP1-85603PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cytokeratin 15 Antibody

  • CK15
  • CK-15
  • cytokeratin 15
  • Cytokeratin-15
  • K15keratin-15, basic
  • K1CO
  • keratin 15
  • keratin, type I cytoskeletal 15
  • Keratin-15
  • keratin-15, beta
  • KRTB
  • type I cytoskeletal 15


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytokeratin 15 Antibody (NBP1-85603) (0)

There are no publications for Cytokeratin 15 Antibody (NBP1-85603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 15 Antibody (NBP1-85603) (0)

There are no reviews for Cytokeratin 15 Antibody (NBP1-85603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytokeratin 15 Antibody (NBP1-85603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytokeratin 15 Products

Bioinformatics Tool for Cytokeratin 15 Antibody (NBP1-85603)

Discover related pathways, diseases and genes to Cytokeratin 15 Antibody (NBP1-85603). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 15 Antibody (NBP1-85603)

Discover more about diseases related to Cytokeratin 15 Antibody (NBP1-85603).

Pathways for Cytokeratin 15 Antibody (NBP1-85603)

View related products by pathway.

PTMs for Cytokeratin 15 Antibody (NBP1-85603)

Learn more about PTMs related to Cytokeratin 15 Antibody (NBP1-85603).

Research Areas for Cytokeratin 15 Antibody (NBP1-85603)

Find related products by research area.

Blogs on Cytokeratin 15

There are no specific blogs for Cytokeratin 15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytokeratin 15 Antibody and receive a gift card or discount.


Gene Symbol KRT15