Cytokeratin 15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human cell line HaCaT shows localization to intermediate filaments. Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Overnight incubation at 4ºC with Keratin 15 antibody diluted 1:400 in PBS/BSA 1%. Green: Cytokeratin 15, Blue: DAPI. Image from verified customer review.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human prostate shows strong membranous positivity in glandular cells.

Staining of human skin shows strong membranous/cytoplasmic positivity in squamous epithelial cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cell lines A-431 and HEK293 using Anti-KRT15 antibody. Corresponding KRT15 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunohistochemistry analysis in human esophagus and liver tissues using HPA023910 antibody. Corresponding KRT15 RNA-seq data are presented for the same tissues.

Staining of human esophagus shows strong membranous/cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytokeratin 15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytokeratin 15 Antibody - BSA Free (NBP1-85603) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Cytokeratin 15 Protein (NBP1-85603PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytokeratin 15 Antibody - BSA Free

• CK15
• CK-15
• cytokeratin 15
• Cytokeratin-15
• K15keratin-15, basic
• K1CO
• keratin 15
• keratin, type I cytoskeletal 15
• Keratin-15
• keratin-15, beta
• KRTB
• type I cytoskeletal 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Cytokeratin 15 Antibody (NBP1-85603) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Patricia Carulla Martí ICC Human 06/13/2023

Summary

• Application: Immunocytochemistry
• Sample Tested: Cultured Human Keratinocytes
• Species: Human
• Lot: A57944

Bioinformatics

• Gene Symbol: KRT15