Cytokeratin 10 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytokeratin 10 Antibody [NBP1-85604] - Analysis in human skin and colon tissues. Corresponding KRT10 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cytokeratin 10 Antibody [NBP1-85604] - Staining of human lymph node shows no positivity as expected.

Immunohistochemistry-Paraffin: Cytokeratin 10 Antibody [NBP1-85604] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: Cytokeratin 10 Antibody [NBP1-85604] - Staining of human colon shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Cytokeratin 10 Antibody [NBP1-85604] - Staining of human kidney shows no positivity in cells in tubules as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytokeratin 10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytokeratin 10 Antibody - BSA Free (NBP1-85604) is a polyclonal antibody validated for use in IHC. Anti-Cytokeratin 10 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cytokeratin 10 Recombinant Protein Antigen (NBP1-85604PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytokeratin 10 Antibody - BSA Free

• BCIE
• BIE
• CK10
• CK-10
• cytokeratin 10
• Cytokeratin-10
• EHK
• K10keratosis palmaris et plantaris
• Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris)
• keratin 10
• keratin, type I cytoskeletal 10
• keratin-10
• KPP

Background

This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytokeratin 10 Antibody (NBP1-85604)(2)

Publications using NBP1-85604

• Zlatar, L;Timm, T;Lochnit, G;Bilyy, R;Bäuerle, T;Munoz-Becerra, M;Schett, G;Knopf, J;Heichel, J;Ali, MJ;Schapher, M;Paulsen, F;Herrmann, M; Neutrophil Extracellular Traps Drive Dacryolithiasis Cells 2023-07-14 [PMID: 37508521] (Immunohistochemistry, Human)
• Kim HJ, Lee E, Lee M et al. Phosphodiesterase 4B plays a role in benzophenone-3-induced phototoxicity in normal human keratinocytes Toxicol. Appl. Pharmacol. 2017-11-25 [PMID: 29183759] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: KRT10