Cytochrome P450 2D6 Antibody

Images

 
Western Blot: Cytochrome P450 2D6 Antibody [NBP1-69671] - This Anti-CYP2D6 antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome P450 2D6 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP2D6(cytochrome P450, family 2, subfamily D, polypeptide 6) The peptide sequence was selected from the middle region of CYP2D6. Peptide sequence EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP2D6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP2D6 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytochrome P450 2D6 Antibody

  • CPD6P450DB1
  • CYP2D
  • CYP2D7AP
  • CYP2D7BP
  • CYP2D7P2
  • CYP2D8P2
  • CYP2DL1
  • CYPIID6
  • cytochrome P450 2D6
  • cytochrome P450, family 2, subfamily D, polypeptide 6
  • cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2
  • cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2
  • cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising)
  • cytochrome P450, subfamily IID (debrisoquine, sparteine, etc.
  • cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising)
  • cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)
  • Cytochrome P450-DB1
  • Debrisoquine 4-hydroxylase
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • -metabolizing)-like 1
  • MGC120389
  • MGC120390
  • microsomal monooxygenase
  • P450C2D
  • P450-DB1
  • polypeptide 6
  • polypeptide 7 pseudogene 2
  • polypeptide 8 pseudogene 2
  • xenobiotic monooxygenase

Background

CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP2-46466
Species: Hu
Applications: IHC
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-69671
Species: Hu
Applications: WB

Publications for Cytochrome P450 2D6 Antibody (NBP1-69671) (0)

There are no publications for Cytochrome P450 2D6 Antibody (NBP1-69671).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 2D6 Antibody (NBP1-69671) (0)

There are no reviews for Cytochrome P450 2D6 Antibody (NBP1-69671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 2D6 Antibody (NBP1-69671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 2D6 Products

Bioinformatics Tool for Cytochrome P450 2D6 Antibody (NBP1-69671)

Discover related pathways, diseases and genes to Cytochrome P450 2D6 Antibody (NBP1-69671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 2D6 Antibody (NBP1-69671)

Discover more about diseases related to Cytochrome P450 2D6 Antibody (NBP1-69671).
 

Pathways for Cytochrome P450 2D6 Antibody (NBP1-69671)

View related products by pathway.

PTMs for Cytochrome P450 2D6 Antibody (NBP1-69671)

Learn more about PTMs related to Cytochrome P450 2D6 Antibody (NBP1-69671).

Blogs on Cytochrome P450 2D6

There are no specific blogs for Cytochrome P450 2D6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 2D6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2D6
Uniprot