Cytochrome P450 1A1 Antibody

Images

 
Western Blot: Cytochrome P450 1A1 Antibody [NBP1-62405] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: Cytochrome P450 1A1 Antibody [NBP1-62405] - Lane 1: Human lung microsome lysate. Lane 2-5: 150 ug mouse lung microsome lysate.
Western Blot: Cytochrome P450 1A1 Antibody [NBP1-62405] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome P450 1A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP1A1(cytochrome P450, family 1, subfamily A, polypeptide 1) The peptide sequence was selected from the middle region of CYP1A1 (NP_000490). Peptide sequence QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP1A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CYP1A1 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-62405.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytochrome P450 1A1 Antibody

  • AHH
  • AHRR
  • aryl hydrocarbon hydroxylase
  • CP11
  • CYP1
  • CYPIA1
  • cytochrome P1-450, dioxin-inducible
  • cytochrome P450 1A1
  • Cytochrome P450 form 6
  • cytochrome P450, family 1, subfamily A, polypeptide 1
  • Cytochrome P450-C
  • Cytochrome P450-P1
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • P1-450
  • P450-C
  • P450DX
  • subfamily I (aromatic compound-inducible), polypeptide 1
  • xenobiotic monooxygenase

Background

CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-59786
Species: Hu
Applications: WB
NBP2-29875
Species: Mu, Rt
Applications: WB
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P

Publications for Cytochrome P450 1A1 Antibody (NBP1-62405)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-62405 Applications Species
Ikeda,S. Am. J. Gastroenterol. 103 (6), 1476-1487. 2008 [PMID: 18510611]

Reviews for Cytochrome P450 1A1 Antibody (NBP1-62405) (0)

There are no reviews for Cytochrome P450 1A1 Antibody (NBP1-62405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 1A1 Antibody (NBP1-62405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 1A1 Products

Bioinformatics Tool for Cytochrome P450 1A1 Antibody (NBP1-62405)

Discover related pathways, diseases and genes to Cytochrome P450 1A1 Antibody (NBP1-62405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 1A1 Antibody (NBP1-62405)

Discover more about diseases related to Cytochrome P450 1A1 Antibody (NBP1-62405).
 

Pathways for Cytochrome P450 1A1 Antibody (NBP1-62405)

View related products by pathway.

PTMs for Cytochrome P450 1A1 Antibody (NBP1-62405)

Learn more about PTMs related to Cytochrome P450 1A1 Antibody (NBP1-62405).

Blogs on Cytochrome P450 1A1

There are no specific blogs for Cytochrome P450 1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 1A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP1A1
Entrez
Uniprot