MOSC2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Analysis in human parathyroid gland and lymph node tissues using NBP1-82167 antibody. Corresponding MARC2 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human cerebral cortex, kidney, lymph node and parathyroid gland using Anti-MARC2 antibody NBP1-82167 (A) shows ...read more
Western Blot: MOSC2 Antibody [NBP1-82167] - Analysis in human cell line TD47D.
Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human lymph node shows very weak granular cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human parathyroid gland shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOSC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25144769). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MOSC2 Recombinant Protein Antigen (NBP1-82167PEP)
Publications
Read Publications using
NBP1-82167 in the following applications:

  • WB
    3 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25144769).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOSC2 Antibody

  • FLJ20605
  • MOCO sulphurase C-terminal domain containing 2
  • MOSC domain-containing protein 2, mitochondrial
  • RP11-270A6.1

Background

Catalytic component of the benzamidoxime prodrug-converting complex, a complex required to reduce N-hydroxylated structures, such as benzamidoxime prodrug. Benzamidoxime is an amidine prodrug produced by N-hydroxylation which is used to enhance bioavailability and increase intestinal absorption. It is then reduced into benzamidine, its active amidine, by the benzamidoxime prodrug-converting complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82122
Species: Hu
Applications: ICC/IF, WB
NBP2-49284
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88039
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-62636
Species: Hu
Applications: IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-02705
Species: Ca, Hu, Pm, Pm
Applications: Flow, IHC, IHC-P, WB
NBP1-83144
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82167
Species: Hu, Mu
Applications: WB, IHC

Publications for MOSC2 Antibody (NBP1-82167)(4)

Reviews for MOSC2 Antibody (NBP1-82167) (0)

There are no reviews for MOSC2 Antibody (NBP1-82167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOSC2 Antibody (NBP1-82167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOSC2 Products

Pathways for MOSC2 Antibody (NBP1-82167)

View related products by pathway.

Blogs on MOSC2

There are no specific blogs for MOSC2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOSC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARC2