MOSC2 Antibody

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining in human parathyroid gland and lymph node tissues using anti-MARC2 antibody. Corresponding MARC2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human cerebral cortex, kidney, lymph node and parathyroid gland using Anti-MARC2 antibody NBP1-82167 (A) shows similar protein distribution across tissues to independent antibody NBP1-82168 (B).

Western Blot: MOSC2 Antibody [NBP1-82167] - Analysis in human cell line TD47D.

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human parathyroid gland using Anti-MARC2 antibody NBP1-82167.

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human kidney.

Immunohistochemistry-Paraffin: MOSC2 Antibody [NBP1-82167] - Staining of human lymph node using Anti-MARC2 antibody NBP1-82167.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MOSC2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25144769). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MOSC2 Recombinant Protein Antigen (NBP1-82167PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25144769).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MOSC2 Antibody

• FLJ20605
• MOCO sulphurase C-terminal domain containing 2
• MOSC domain-containing protein 2, mitochondrial
• RP11-270A6.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MOSC2 Antibody (NBP1-82167)(4)

Publications using NBP1-82167

• Neve EP, Kofeler H, Hendriks DF et al. Expression and Function of mARC: Roles in Lipogenesis and Metabolic Activation of Ximelagatran. PLoS One 2015 [PMID: 26378779] (WB, Human)
• Thinon E, Serwa RA, Broncel M et al. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nat Commun 2014 Sep 26 [PMID: 25255805] (WB, Human)
• Jakobs HH, Mikula M, Havemeyer A et al. The N-Reductive System Composed of Mitochondrial Amidoxime Reducing Component (mARC), Cytochrome b5 (CYB5B) and Cytochrome b5 Reductase (CYB5R) Is Regulated by Fasting and High Fat Diet in Mice. PLoS One 2014 [PMID: 25144769] (WB, Mouse)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: 23435261]

Bioinformatics

• Gene Symbol: MARC2