CYTIP Antibody - BSA Free

Western Blot: CYTIP Antibody [NBP2-84751] - Host: Rabbit. Target Name: Cytip. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CYTIP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CYTIP Antibody - BSA Free (NBP2-84751) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse CYTIP. Peptide sequence: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYTIP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CYTIP Antibody - BSA Free

• B3-1
• CASPCytohesin-associated scaffolding protein
• Cbp HE
• CYBRCytohesin-binding protein HE
• CYTHIP
• cytohesin 1 interacting protein
• Cytohesin binder and regulator
• cytohesin-1 interacting protein
• cytohesin-interacting protein
• HEPleckstrin homology Sec7 and coiled-coil domains-binding protein
• pleckstrin homology, Sec7 and coiled/coil domains, binding protein
• pleckstrin homology, Sec7 and coiled-coil domains, binding protein
• PSCDBPcytohesin binding protein HE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYTIP