Cysteinyl Leukotriene R2/CysLTR2 Antibody


Immunohistochemistry-Paraffin: CysLT2 Antibody [NBP2-13897] Staining of human placenta shows cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Cysteinyl Leukotriene R2/CysLTR2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE
Specificity of human Cysteinyl Leukotriene R2/CysLTR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cysteinyl Leukotriene R2/CysLTR2 Protein (NBP2-13897PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cysteinyl Leukotriene R2/CysLTR2 Antibody

  • CysLT(2)
  • CysLT2
  • CYSLT2KPG_011
  • CysLTR2
  • cysteinyl leukotriene CysLT2 receptor
  • Cysteinyl Leukotriene R2
  • cysteinyl leukotriene receptor 2
  • Cysteinyl LeukotrieneR2
  • G protein-coupled receptor
  • G-protein coupled receptor GPCR21
  • G-protein coupled receptor HG57
  • HG57
  • hGPCR21
  • HPN321
  • KPG_011


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk, Pm
Applications: Flow, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897) (0)

There are no publications for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897) (0)

There are no reviews for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cysteinyl Leukotriene R2/CysLTR2 Products

Bioinformatics Tool for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897)

Discover related pathways, diseases and genes to Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897)

Discover more about diseases related to Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897).

Pathways for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897)

View related products by pathway.

Research Areas for Cysteinyl Leukotriene R2/CysLTR2 Antibody (NBP2-13897)

Find related products by research area.

Blogs on Cysteinyl Leukotriene R2/CysLTR2

There are no specific blogs for Cysteinyl Leukotriene R2/CysLTR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cysteinyl Leukotriene R2/CysLTR2 Antibody and receive a gift card or discount.


Gene Symbol CYSLTR2