Cysteine Dioxygenase Type 1 Antibody - Azide and BSA Free Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
CDO1 (NP_001792.2, 1 a.a. - 200 a.a.) full-length human protein. MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN |
Specificity |
CDO1 - cysteine dioxygenase, type I, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
CDO1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Cysteine Dioxygenase Type 1 Antibody - Azide and BSA Free
Background
Cysteine Dioxygenase Type 1 is a 23 kDa 200 amino acid protein which has a role in initiating metabolic pathways as well as altering intracellular cysteine and glutathione levels. Cysteine Dioxygenase Type 1 is known to interact with VHL, MAPK14, SPAG9, CSAD and CTH. Cysteine Dioxygenase Type 1 has been studied in relation to breast cancer, cutaneous t cell lymphoma, hepatoblastoma and hepatitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, Simple Western
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Bt, Bv, Ca, Ha, Hu, Pm, Rb
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: WB
Publications for Cysteine Dioxygenase Type 1 Antibody (H00001036-B01P) (0)
There are no publications for Cysteine Dioxygenase Type 1 Antibody (H00001036-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cysteine Dioxygenase Type 1 Antibody (H00001036-B01P) (0)
There are no reviews for Cysteine Dioxygenase Type 1 Antibody (H00001036-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cysteine Dioxygenase Type 1 Antibody (H00001036-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cysteine Dioxygenase Type 1 Products
Research Areas for Cysteine Dioxygenase Type 1 Antibody (H00001036-B01P)
Find related products by research area.
|
Blogs on Cysteine Dioxygenase Type 1