CYP27A1 Antibody (6L9D1)

Western Blot: CYP27A1 Antibody (6L9D1) [NBP3-33416] - Western blot analysis of various lysates, using CYP27A1 Rabbit mAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 6L9D1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CYP27A1 Antibody (6L9D1) Summary

• Description: Novus Biologicals Rabbit CYP27A1 Antibody (6L9D1) (NBP3-33416) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 431-530 of human CYP27A1 (NP_000775.1).
  
  Sequence:
  VSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQ
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CYP27A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CYP27A1 Antibody (6L9D1)

• 12-alpha-triol 27-hydroxylase
• 7-alpha
• cholestanetriol 26-monooxygenase
• CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase
• CTX5-beta-cholestane-3-alpha
• CYP27
• CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase
• CYP27A1
• Cytochrome P450 27
• cytochrome P450, family 27, subfamily A, polypeptide 1
• cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1
• Cytochrome P-450C27/25
• EC 1.14.13.15
• EC 1.14.15.15
• sterol 26-hydroxylase, mitochondrial
• Sterol 27-hydroxylase
• Vitamin D(3) 25-hydroxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP27A1