Cyclin F Antibody

Images

 
Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human liver.
Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human tonsil shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining in human tonsil and pancreas tissues using anti-CCNF antibody. Corresponding CCNF RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human liver, lymph node, pancreas and skin using Anti-CCNF antibody NBP2-57349 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human skin.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclin F Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVR
Specificity
Specificity of human Cyclin F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNF
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cyclin F Recombinant Protein Antigen (NBP2-57349PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Cyclin F Antibody

  • cyclin F
  • cyclin-F
  • FBX1FBXO1F-box only protein 1
  • G2/mitotic-specific cyclin-F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF5510
Species: Hu
Applications: WB
AF1555
Species: Hu
Applications: WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31330
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31661
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-57349
Species: Hu
Applications: IHC, IHC-P

Publications for Cyclin F Antibody (NBP2-57349) (0)

There are no publications for Cyclin F Antibody (NBP2-57349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin F Antibody (NBP2-57349) (0)

There are no reviews for Cyclin F Antibody (NBP2-57349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cyclin F Antibody (NBP2-57349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cyclin F Products

Bioinformatics Tool for Cyclin F Antibody (NBP2-57349)

Discover related pathways, diseases and genes to Cyclin F Antibody (NBP2-57349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin F Antibody (NBP2-57349)

Discover more about diseases related to Cyclin F Antibody (NBP2-57349).
 

Pathways for Cyclin F Antibody (NBP2-57349)

View related products by pathway.

PTMs for Cyclin F Antibody (NBP2-57349)

Learn more about PTMs related to Cyclin F Antibody (NBP2-57349).
 

Research Areas for Cyclin F Antibody (NBP2-57349)

Find related products by research area.

Blogs on Cyclin F

There are no specific blogs for Cyclin F, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNF