CYB5R3 Antibody

Images

 
Western Blot: CYB5R3 Antibody [NBP1-84252] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: CYB5R3 Antibody [NBP1-84252] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: CYB5R3 Antibody [NBP1-84252] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYB5R3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYB5R3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CYB5R3 Protein (NBP1-84252PEP)
Publications
Read Publication using
NBP1-84252 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%). Mouse reactivity reported in scientific literature (PMID: 25144769).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYB5R3 Antibody

  • B5RNADH-cytochrome b5 reductase 3
  • cytochrome b5 reductase 3
  • Cytochrome b5 reductase
  • DIA1NADH-cytochrome b5 reductase 3 membrane-bound form
  • diaphorase (NADH) (cytochrome b-5 reductase)
  • diaphorase-1
  • EC 1.6.2.2
  • NADH-cytochrome b5 reductase 3 soluble form

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF2485
Species: Hu
Applications: WB, IHC, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-57268
Species: Hu
Applications: WB, ICC/IF
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for CYB5R3 Antibody (NBP1-84252)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for CYB5R3 Antibody (NBP1-84252) (0)

There are no reviews for CYB5R3 Antibody (NBP1-84252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYB5R3 Antibody (NBP1-84252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYB5R3 Products

Bioinformatics Tool for CYB5R3 Antibody (NBP1-84252)

Discover related pathways, diseases and genes to CYB5R3 Antibody (NBP1-84252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYB5R3 Antibody (NBP1-84252)

Discover more about diseases related to CYB5R3 Antibody (NBP1-84252).
 

Pathways for CYB5R3 Antibody (NBP1-84252)

View related products by pathway.

PTMs for CYB5R3 Antibody (NBP1-84252)

Learn more about PTMs related to CYB5R3 Antibody (NBP1-84252).

Blogs on CYB5R3

There are no specific blogs for CYB5R3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYB5R3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYB5R3