CXXC1 Antibody - BSA Free

Western Blot: CXXC1 Antibody [NBP2-84741] - WB Suggested Anti-Cxxc1 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Testis

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CXXC1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat CXXC1. Peptide sequence: HGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKCRERDGSERDGS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CXXC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CXXC1 Antibody - BSA Free

• CFP1CXXC-type zinc finger protein 1
• CGBPPHD finger and CXXC domain-containing protein 1
• CpG binding protein
• cpG-binding protein
• CXXC finger 1 (PHD domain)
• CXXC finger protein 1
• DNA-binding protein with PHD finger and CXXC domain
• hCGBP
• HsT2645
• PCCX12410002I16Rik
• PHF185830420C16Rik
• SPP1
• ZCGPC1
• zinc finger, CpG binding-type containing 1

Background

Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001 (PubMed 11604496)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CXXC1