CXCR7/RDC-1 Antibody


Immunohistochemistry-Paraffin: CXCR7/RDC-1 Antibody [NBP2-13885] - Staining of human placenta shows cytoplasmic positivity in trophoblasts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CXCR7/RDC-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXCR7/RDC-1 Protein (NBP2-13885PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CXCR7/RDC-1 Antibody

  • ACKR3
  • chemokine (C-X-C motif) receptor 7
  • Chemokine orphan receptor 1CMKOR1C-X-C chemokine receptor type 7
  • CMKOR1
  • CXCR7
  • CXC-R7
  • CXCR-7
  • G protein-coupled receptor
  • GPR159
  • GPR159G-protein coupled receptor 159
  • RDC-1
  • RDC1G-protein coupled receptor RDC1 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut

Publications for CXCR7/RDC-1 Antibody (NBP2-13885) (0)

There are no publications for CXCR7/RDC-1 Antibody (NBP2-13885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCR7/RDC-1 Antibody (NBP2-13885) (0)

There are no reviews for CXCR7/RDC-1 Antibody (NBP2-13885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXCR7/RDC-1 Antibody (NBP2-13885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CXCR7/RDC-1 Products

Bioinformatics Tool for CXCR7/RDC-1 Antibody (NBP2-13885)

Discover related pathways, diseases and genes to CXCR7/RDC-1 Antibody (NBP2-13885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCR7/RDC-1 Antibody (NBP2-13885)

Discover more about diseases related to CXCR7/RDC-1 Antibody (NBP2-13885).

Pathways for CXCR7/RDC-1 Antibody (NBP2-13885)

View related products by pathway.

PTMs for CXCR7/RDC-1 Antibody (NBP2-13885)

Learn more about PTMs related to CXCR7/RDC-1 Antibody (NBP2-13885).

Research Areas for CXCR7/RDC-1 Antibody (NBP2-13885)

Find related products by research area.

Blogs on CXCR7/RDC-1

There are no specific blogs for CXCR7/RDC-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CXCR7/RDC-1 Antibody and receive a gift card or discount.


Gene Symbol CXCR7