CUEDC2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CUEDC2 Antibody [NBP2-58980] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CUEDC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CUEDC2 Antibody - BSA Free (NBP2-58980) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CUEDC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CUEDC2 Recombinant Protein Antigen (NBP2-58980PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CUEDC2 Antibody - BSA Free

• bA18I14.5
• C10orf66
• chromosome 10 open reading frame 66
• CUE domain containing 2
• CUE domain-containing protein 2
• MGC2491

Background

Controls PGR and ESR1 protein levels through their targeting for ubiquitination and subsequent proteasomaldegradation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CUEDC2