![Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining in human kidney and liver tissues using NBP2-62596 antibody. Corresponding CUBN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cubilin-Antibody-Immunohistochemistry-Paraffin-NBP2-62596-img0017.jpg "Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining in human kidney and liver tissues using NBP2-62596 antibody. Corresponding CUBN RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PNGDSSCNQGDYLVLRNGPDIYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CUBN |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CUBN |
![Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human kidney, liver, prostate and small intestine using Anti-CUBN antibody NBP2-62596 (A) shows similar protein distribution across tissues to independent antibody NBP2-62611 (B).](http://images.novusbio.com/fullsize/Cubilin-Antibody-Immunohistochemistry-Paraffin-NBP2-62596-img0013.jpg "Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human kidney, liver, prostate and small intestine using Anti-CUBN antibody NBP2-62596 (A) shows similar protein distribution across tissues to independent antibody NBP2-62611 (B).")
![Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human kidney shows strong positivity in apical membrane in cells in proximal tubules.](http://images.novusbio.com/fullsize/Cubilin-Antibody-Immunohistochemistry-Paraffin-NBP2-62596-img0012.jpg "Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human kidney shows strong positivity in apical membrane in cells in proximal tubules.")
![Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Cubilin-Antibody-Immunohistochemistry-Paraffin-NBP2-62596-img0014.jpg "Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Cubilin-Antibody-Immunohistochemistry-Paraffin-NBP2-62596-img0015.jpg "Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Cubilin-Antibody-Immunohistochemistry-Paraffin-NBP2-62596-img0016.jpg "Immunohistochemistry-Paraffin: Cubilin Antibody [NBP2-62596] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.")
![Simple Western Apolipoprotein A-I/ApoA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_AI_AF3664_Simple_Western_21892.jpg)
![Western Blot Apolipoprotein A-I/ApoA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_AI_AF3664_Western_Blot_21923.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Immunohistochemistry Somatostatin Antibody (906552) [Unconjugated]](https://images.novusbio.com/images2/Somatostatin_MAB2358_Immunohistochemistry_20948.jpg)
![Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]](https://images.novusbio.com/images2/Somatostatin_MAB2358_Immunocytochemistry__Immunofluorescence_18392.jpg)
![Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]](https://images.novusbio.com/images2/Somatostatin_MAB2358_Immunocytochemistry__Immunofluorescence_18393.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")