CTRP7 Antibody

Western Blot: CTRP7 Antibody [H00114905-B01P] - Analysis of C1QTNF7 expression in transfected 293T cell line by C1QTNF7 polyclonal antibody. Lane 1: C1QTNF7 transfected lysate(31.79 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

CTRP7 Antibody Summary

• Immunogen: C1QTNF7 (NP_114117.1, 1 a.a. - 289 a.a.) full-length human protein. MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL
• Specificity: Mouse Polyclonal to C1QTNF7
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: C1QTNF7
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CTRP7 Antibody

• C1q and tumor necrosis factor related protein 7
• C1qTNF7
• complement-c1q tumor necrosis factor-related protein 7
• CTRP7
• CTRP7complement C1q tumor necrosis factor-related protein 7
• ZACRP7

Background

Adipose tissue of an organism plays a major role in regulating physiologic and pathologic processes such as metabolism and immunity by producing and secreting a variety of bioactive molecules termed adipokines. One highly conserved family of adipokines is adiponectin/ACRP30 and its structural and functional paralogs, the C1q/tumor necrosis factor-a-related proteins (CTRPs) 1-7. Unlike adiponectin, which is expressed exclusively by differentiated adipocytes, the CTRPs are expressed in a wide variety of tissues. These proteins are thought to act mainly on liver and muscle tissue to control glucose and lipid metabolism. An analysis of the crystal structure of adiponectin revealed a structural and evolutionary link between TNF and C1q-containing proteins, suggesting that these proteins arose from a common ancestral innate immunity gene. Like the other members of the adiponectin and CTRP protein family, the mature CTRP7 is secreted and can be found in the organism's circulatory system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C1QTNF7
• Entrez:
  • 114905(Human)
• Uniprot:
  • NP_114117.1(Human)