CTR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CTR2 Antibody [NBP1-85512] - Staining human cell line U-251 MG shows positivity in cytoplasm, intermediate filaments and nucleus but excluded from the nucleoli. Antibody ...read more
Immunohistochemistry-Paraffin: CTR2 Antibody [NBP1-85512] - Staining of human salivary gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC31A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CTR2 Protein (NBP1-85512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTR2 Antibody

  • Copper transporter 2
  • COPT2SLC13A2
  • CTR2Solute carrier family 31 member 2
  • hCTR2probable low affinity copper uptake protein 2
  • solute carrier family 31 (copper transporters), member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-06611
Species: Hu
Applications: WB, ICC/IF
AF6428
Species: Hu
Applications: WB, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-01853
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF6517
Species: Hu
Applications: WB
AF4875
Species: Hu
Applications: WB

Publications for CTR2 Antibody (NBP1-85512) (0)

There are no publications for CTR2 Antibody (NBP1-85512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTR2 Antibody (NBP1-85512) (0)

There are no reviews for CTR2 Antibody (NBP1-85512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CTR2 Antibody (NBP1-85512). (Showing 1 - 1 of 1 FAQ).

  1. I have searched your website to find ctr2 antibody for my rat experiment(mainly about IHC &WB), however, I found most ctr2 antibody used for mouse and human not for rat.Could you help me to check the information on ctr2 antibody ?Thanks a lot!
    • We have two antibodies to CTR2 - NBP1-05199 which is validated for Western blotting using samples from human and mouse, and NBP1-85512 which is validated for IHC-P using human samples. Human and mouse CTR2 share a 77% sequence homology, however I am unable to align either of these sequence with that of the rat protein, since the rat sequence is not available on UniProt. If you have the rat sequence I would be happy to perform the alignment for you, email technical@novusbio.com. If you wish to try either of these antibodies in an untested species or application I can strongly recommend our Innovators Reward Program. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. This allows us to gain more information on our products, and enables you to save money.

Secondary Antibodies

 

Isotype Controls

Additional CTR2 Products

Bioinformatics Tool for CTR2 Antibody (NBP1-85512)

Discover related pathways, diseases and genes to CTR2 Antibody (NBP1-85512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CTR2 Antibody (NBP1-85512)

View related products by pathway.

Research Areas for CTR2 Antibody (NBP1-85512)

Find related products by research area.

Blogs on CTR2

There are no specific blogs for CTR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC31A2