CTR2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CTR2 Antibody [NBP1-85512] - Staining human cell line U-251 MG shows positivity in cytoplasm, intermediate filaments and nucleus but excluded from the nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CTR2 Antibody [NBP1-85512] - Staining of human salivary gland shows cytoplasmic positivity in glandular cells.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CTR2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CTR2 Antibody - BSA Free (NBP1-85512) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-CTR2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC31A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CTR2 Protein (NBP1-85512PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CTR2 Antibody - BSA Free

• Copper transporter 2
• COPT2SLC13A2
• CTR2Solute carrier family 31 member 2
• hCTR2probable low affinity copper uptake protein 2
• solute carrier family 31 (copper transporters), member 2

Background

SLC31A2, also known as CTR2, is a SLC31A transporter family member. Although the function of CTR2 is still poorly understood in mammalian cells, it is expected to be involved in low-affinity copper uptake. It is believed to be confined to lysosomes which stimulate copper delivery to the the cytosol of human cells at high concentrations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CTR2 Antibody (NBP1-85512)(1)

Publication using NBP1-85512

• Solier S, Müller S, Cañeque T et al. A druggable copper-signalling pathway that drives inflammation Nature 2023-04-26 [PMID: 37100912] (IHC, Human)

FAQs for CTR2 Antibody (NBP1-85512). (Showing 1 - 1 of 1 FAQ).

1. I have searched your website to find ctr2 antibody for my rat experiment(mainly about IHC &WB), however, I found most ctr2 antibody used for mouse and human not for rat.Could you help me to check the information on ctr2 antibody ?Thanks a lot!
   • We have two antibodies to CTR2 - NBP1-05199 which is validated for Western blotting using samples from human and mouse, and NBP1-85512 which is validated for IHC-P using human samples. Human and mouse CTR2 share a 77% sequence homology, however I am unable to align either of these sequence with that of the rat protein, since the rat sequence is not available on UniProt. If you have the rat sequence I would be happy to perform the alignment for you, email technical@novusbio.com. If you wish to try either of these antibodies in an untested species or application I can strongly recommend our Innovators Reward Program. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. This allows us to gain more information on our products, and enables you to save money.

Bioinformatics

• Gene Symbol: SLC31A2