CTNNA3 Antibody

Images

 
Immunohistochemistry-Paraffin: CTNNA3 Antibody [NBP2-49348] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CTNNA3 Antibody [NBP2-49348] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: CTNNA3 Antibody [NBP2-49348] - Staining in human heart muscle and pancreas tissues using anti-CTNNA3 antibody. Corresponding CTNNA3 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTNNA3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICS
Specificity
Specificity of human CTNNA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTNNA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CTNNA3 Recombinant Protein Antigen (NBP2-49348PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTNNA3 Antibody

  • Alpha T-catenin
  • alpha-catenin-like protein
  • alpha-T-catenin
  • Cadherin-associated protein
  • catenin (cadherin-associated protein), alpha 3
  • catenin alpha-3
  • MGC26194
  • MGC75041
  • VR22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
H00001496-B01P
Species: Hu, Rt
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33341
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF4898
Species: Hu, Mu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-66907
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, IHC, IHC-P
NBP1-78278
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-49348
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for CTNNA3 Antibody (NBP2-49348) (0)

There are no publications for CTNNA3 Antibody (NBP2-49348).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTNNA3 Antibody (NBP2-49348) (0)

There are no reviews for CTNNA3 Antibody (NBP2-49348). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CTNNA3 Antibody (NBP2-49348) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CTNNA3 Antibody (NBP2-49348)

Discover related pathways, diseases and genes to CTNNA3 Antibody (NBP2-49348). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTNNA3 Antibody (NBP2-49348)

Discover more about diseases related to CTNNA3 Antibody (NBP2-49348).
 

Pathways for CTNNA3 Antibody (NBP2-49348)

View related products by pathway.

PTMs for CTNNA3 Antibody (NBP2-49348)

Learn more about PTMs related to CTNNA3 Antibody (NBP2-49348).

Blogs on CTNNA3

There are no specific blogs for CTNNA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTNNA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNNA3