STOX1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STOX1 Antibody [NBP1-90745] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: STOX1 Antibody [NBP1-90745] - Staining of human fallopian tube shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STOX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STOX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STOX1 Protein (NBP1-90745PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STOX1 Antibody

  • C10orf24
  • PEE4
  • storkhead box 1
  • storkhead-box protein 1
  • winged-helix domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97719
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-92382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
MAB3207
Species: Hu, Mu, Rt
Applications: WB
NBP2-30480
Species: Hu
Applications: WB, IHC, IHC-P
H00091833-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03265
Species: Hu
Applications: WB, Flow, ICC/IF
H00010210-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF340
Species: Hu
Applications: WB, IHC, Block
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4898
Species: Hu, Mu
Applications: WB, IHC
NBP1-90745
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for STOX1 Antibody (NBP1-90745) (0)

There are no publications for STOX1 Antibody (NBP1-90745).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STOX1 Antibody (NBP1-90745) (0)

There are no reviews for STOX1 Antibody (NBP1-90745). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STOX1 Antibody (NBP1-90745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STOX1 Products

STOX1 NBP1-90745

Bioinformatics Tool for STOX1 Antibody (NBP1-90745)

Discover related pathways, diseases and genes to STOX1 Antibody (NBP1-90745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STOX1 Antibody (NBP1-90745)

Discover more about diseases related to STOX1 Antibody (NBP1-90745).
 

Pathways for STOX1 Antibody (NBP1-90745)

View related products by pathway.

PTMs for STOX1 Antibody (NBP1-90745)

Learn more about PTMs related to STOX1 Antibody (NBP1-90745).

Blogs on STOX1

There are no specific blogs for STOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STOX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STOX1