Catenin alpha 2 Antibody - Azide and BSA Free

Western Blot: Catenin alpha 2 Antibody - Azide and BSA Free [NBP2-92753] - Western blot analysis of various lysates using Catenin alpha 2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

Immunohistochemistry-Paraffin: Catenin alpha 2 Antibody [NBP2-92753] - Rat liver using CTNNA2 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: Catenin alpha 2 Antibody [NBP2-92753] - Mouse liver using CTNNA2 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: Catenin alpha 2 Antibody [NBP2-92753] - Mouse spinal cord using CTNNA2 antibody at dilution of 1:100 (40x lens).

Immunocytochemistry/ Immunofluorescence: Catenin alpha 2 Antibody - Azide and BSA Free [NBP2-92753] - Immunofluorescence analysis of PC-12 cells using Catenin alpha 2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Catenin alpha 2 Antibody - Azide and BSA Free [NBP2-92753] - Immunofluorescence analysis of Neuro-2a cells using Catenin alpha 2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Catenin alpha 2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Catenin alpha 2 Antibody - Azide and BSA Free (NBP2-92753) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 167-290 of human Catenin alpha 2 (NP_001269526.1). TNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTNNA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Catenin alpha 2 Antibody - Azide and BSA Free

• Alpha-catenin-related protein
• cancer/testis antigen 114
• CAPRrelated
• catenin (cadherin-associated protein), alpha 2
• catenin alpha-2
• CTNR
• DKFZp686H02198

Background

It has been shown that alpha N-catenin, a linker between cadherin adhesion receptors and the actin cytoskeleton, is essential for stabilizing dendritic spines in rodent hippocampal neurons in culture. Results suggest that alpha N-catenin is a key regulator for the stability of synaptic contacts (1). We show here that antibodies against alpha catenin also immunoprecipitate complexes that contain human N-cadherin, mouse P-cadherin, chicken A-CAM (adherens junction-specific CAM; also called N-cadherin) or Xenopus U-cadherin, demonstrating that alpha catenin is complexed with other cadherins(2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTNNA2