Ctip1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Ctip1 Antibody [NBP3-17030] - Analysis in human tonsil and placenta tissues using Anti-BCL11A antibody. Corresponding BCL11A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Ctip1 Antibody [NBP3-17030] - Staining of human placenta shows low expression as expected.

Immunohistochemistry-Paraffin: Ctip1 Antibody [NBP3-17030] - Staining of human cerebral cortex shows nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: Ctip1 Antibody [NBP3-17030] - Staining of human tonsil shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ctip1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ctip1 Antibody - BSA Free (NBP3-17030) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGC
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCL11A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ctip1 Antibody - BSA Free

• B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2
• B-cell CLL/lymphoma 11A (zinc finger protein)
• B-cell CLL/lymphoma 11A
• B-cell lymphoma/leukemia 11A
• BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1
• BCL-11A
• BCL11A-S
• BCL11A-XL
• C2H2-type zinc finger protein
• COUP-TF-interacting protein 1
• CTIP1ecotropic viral integration site 9
• ecotropic viral integration site 9 homolog
• Ecotropic viral integration site 9 protein homolog
• EVI-9
• EVI9FLJ34997
• HBFQTL5
• KIAA1809BCL11A-L
• Zinc finger protein 856
• ZNF856FLJ10173

Background

The Ctip1 gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, throug

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL11A