CTCF Antibody (4W9B0)

Western Blot: CTCF Antibody (4W9B0) [NBP3-15795] - Western blot analysis of extracts of various cell lines, using CTCF antibody (NBP3-15795) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of NIH-3T3 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.

Chromatin Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (NBP3-15795) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of C6 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.

Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug CTCF antibody (NBP3-15795). Western blot was performed from the immunoprecipitate using CTCF antibody (NBP3-15795) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IP, ChIP
• Clone: 4W9B0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CTCF Antibody (4W9B0) Summary

• Description: Novus Biologicals Rabbit CTCF Antibody (4W9B0) (NBP3-15795) is a recombinant monoclonal antibody validated for use in WB, ELISA, ICC/IF, IP and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711). PAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CTCF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 3μg antibody for 10 ug-15 ug of chromatin
  • Chromatin Immunoprecipitation Sequencing 1:50 - 1:100
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:200 - 1:800
  • Immunoprecipitation 0.5μg-4μg antibody for 200 ug-400 ug extracts of whole cells
  • Western Blot 1:1000 - 1:4000
• Theoretical MW: 83 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for CTCF Antibody (4W9B0)

• 11 zinc finger transcriptional repressor
• 11-zinc finger protein
• 11-Zinc Finger Protein2
• CCCTC-binding factor (zinc finger protein)
• CCCTC-binding Factor
• CTCF
• CTCFL paralog
• transcriptional repressor CTCF

Background

The CTCF gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA tar

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTCF