CSRP1 Antibody (2A11)

Images

 
Immunocytochemistry/ Immunofluorescence: CSRP1 Antibody (2A11) [H00001465-M06] - Analysis of monoclonal antibody to CSRP1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: CSRP1 Antibody (2A11) [H00001465-M06] - Detection limit for recombinant GST tagged CSRP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CSRP1 Antibody (2A11) Summary

Immunogen
CSRP1 (NP_004069, 94 a.a. - 192 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS
Specificity
CSRP1 - cysteine and glycine-rich protein 1 (2A11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSRP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CSRP1 Antibody (2A11)

  • CRP
  • CRP1
  • CSRP1
  • CSRPCYRP
  • CYRP
  • cysteine and glycine-rich protein 1
  • Cysteine-rich protein 1
  • D1S181E
  • DKFZp686M148
  • LIM-domain protein

Background

CSRP1 is a member of the CSRP family of genes encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in CRP1 is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation Other genes in the family include CSRP2 and CSRP3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4409
Species: Mu
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CSRP1 Antibody (H00001465-M06) (0)

There are no publications for CSRP1 Antibody (H00001465-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP1 Antibody (H00001465-M06) (0)

There are no reviews for CSRP1 Antibody (H00001465-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSRP1 Antibody (H00001465-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSRP1 Products

Bioinformatics Tool for CSRP1 Antibody (H00001465-M06)

Discover related pathways, diseases and genes to CSRP1 Antibody (H00001465-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP1 Antibody (H00001465-M06)

Discover more about diseases related to CSRP1 Antibody (H00001465-M06).
 

Pathways for CSRP1 Antibody (H00001465-M06)

View related products by pathway.

PTMs for CSRP1 Antibody (H00001465-M06)

Learn more about PTMs related to CSRP1 Antibody (H00001465-M06).

Blogs on CSRP1

There are no specific blogs for CSRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSRP1 Antibody (2A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSRP1
Entrez
Uniprot