CSAD Antibody

Images

 
Immunohistochemistry-Paraffin: CSAD Antibody [NBP1-84373] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CSAD Protein (NBP1-84373PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSAD Antibody

  • CSDMGC119355
  • cysteine sulfinic acid decarboxylase
  • Cysteine-sulfinate decarboxylase
  • EC 4.1.1
  • EC 4.1.1.29
  • FLJ44987
  • FLJ45500
  • MGC119354
  • MGC119357
  • PCAP
  • P-selectin cytoplasmic tail-associated protein
  • Sulfinoalanine decarboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-33988
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF2429
Species: Mu
Applications: WB, IHC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-84373
Species: Hu
Applications: IHC, IHC-P

Publications for CSAD Antibody (NBP1-84373) (0)

There are no publications for CSAD Antibody (NBP1-84373).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSAD Antibody (NBP1-84373) (0)

There are no reviews for CSAD Antibody (NBP1-84373). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CSAD Antibody (NBP1-84373) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSAD Products

Bioinformatics Tool for CSAD Antibody (NBP1-84373)

Discover related pathways, diseases and genes to CSAD Antibody (NBP1-84373). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSAD Antibody (NBP1-84373)

Discover more about diseases related to CSAD Antibody (NBP1-84373).
 

Pathways for CSAD Antibody (NBP1-84373)

View related products by pathway.

PTMs for CSAD Antibody (NBP1-84373)

Learn more about PTMs related to CSAD Antibody (NBP1-84373).

Blogs on CSAD

There are no specific blogs for CSAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSAD