CRYZ Antibody

Images

 
Western Blot: CRYZ Antibody [NBP1-89536] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: CRYZ Antibody [NBP1-89536] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CRYZ Antibody [NBP1-89536] - Staining of human liver shows strong positivity in hepatocytes and bile duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRYZ Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRYZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRYZ Protein (NBP1-89536PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRYZ Antibody

  • crystallin, zeta (quinone reductase)
  • DKFZp779E0834
  • EC 1.6.5.5
  • FLJ41475
  • NADPH:quinone reductase
  • quinone oxidoreductase
  • zeta-crystallin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-31563
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03319
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi

Publications for CRYZ Antibody (NBP1-89536) (0)

There are no publications for CRYZ Antibody (NBP1-89536).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRYZ Antibody (NBP1-89536) (0)

There are no reviews for CRYZ Antibody (NBP1-89536). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRYZ Antibody (NBP1-89536) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRYZ Products

Bioinformatics Tool for CRYZ Antibody (NBP1-89536)

Discover related pathways, diseases and genes to CRYZ Antibody (NBP1-89536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRYZ Antibody (NBP1-89536)

Discover more about diseases related to CRYZ Antibody (NBP1-89536).
 

Pathways for CRYZ Antibody (NBP1-89536)

View related products by pathway.

Research Areas for CRYZ Antibody (NBP1-89536)

Find related products by research area.

Blogs on CRYZ

There are no specific blogs for CRYZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRYZ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYZ