CRTAC1 Antibody

Images

 
Western Blot: CRTAC1 Antibody [NBP1-88864] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human lung tissue.
Immunohistochemistry: CRTAC1 Antibody [NBP1-88864] - Staining of human heart muscle shows strong cytoplasmic positivity in dot like pattern in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRTAC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRTAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRTAC1 Protein (NBP1-88864PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRTAC1 Antibody

  • ASPIC
  • ASPIC1
  • ASPIC1CEP-68acidic secreted protein in cartilage
  • cartilage acidic protein 1
  • CEP68
  • chondrocyte expressed protein 68 kDa CEP-68,68 kDa chondrocyte-expressed protein
  • CRTAC1
  • FLJ10320

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
AF3075
Species: Hu
Applications: WB, ICC
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33194
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59027
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-45912
Species: Hu
Applications: WB, IHC
NBP1-80820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CRTAC1 Antibody (NBP1-88864) (0)

There are no publications for CRTAC1 Antibody (NBP1-88864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRTAC1 Antibody (NBP1-88864) (0)

There are no reviews for CRTAC1 Antibody (NBP1-88864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRTAC1 Antibody (NBP1-88864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRTAC1 Products

Bioinformatics Tool for CRTAC1 Antibody (NBP1-88864)

Discover related pathways, diseases and genes to CRTAC1 Antibody (NBP1-88864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRTAC1 Antibody (NBP1-88864)

Discover more about diseases related to CRTAC1 Antibody (NBP1-88864).
 

Pathways for CRTAC1 Antibody (NBP1-88864)

View related products by pathway.

PTMs for CRTAC1 Antibody (NBP1-88864)

Learn more about PTMs related to CRTAC1 Antibody (NBP1-88864).

Blogs on CRTAC1

There are no specific blogs for CRTAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRTAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTAC1
Entrez