CRM1 Recombinant Protein Antigen

Images

 
There are currently no images for CRM1 Protein (NBP2-33381PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CRM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XPO1.

Source: E. coli

Amino Acid Sequence: HTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
XPO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33381.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRM1 Recombinant Protein Antigen

  • Chromosome region maintenance 1 protein homolog
  • DKFZp686B1823
  • emb
  • exp1
  • exportin 1 (CRM1 homolog, yeast)
  • exportin 1 (CRM1, yeast, homolog)
  • Exportin-1 (required for chromosome region maintenance)
  • exportin-1
  • yeast, homolog

Background

Official Gene Symbol: XPO1 Gen Bank Accession Number: NP_003391 Gene ID: 7514 (human) Gene Map Locus: 2p16 (human) Nuclear transport receptors of karyopherin/importin-beta superfamily mediate various transport pathways between nucleus and cytoplasm. Exportin-1, a human homolog of yeast CRM1, is a novel karyopherin export receptor that mediates leucine-rich NES-dependent protein export. It interacts with RanGTP through its Ran-binding domain and also with nucleoporins including Nup214, Nup50, Nup42 and Nup159 during the process of exporting NES-containing proteins. It mediates the export of many cellular and viral proteins and ribonucleoproteins including HIV Rev Protein, ERK3, PKI, IRF-5, Cyclin-B, MAPKK, MAPKAP kinase 2, Snurportin, Cap-binding protein, and certain U snRNAs. Reports suggest exportin-1 also has a role in the regulation of NFAT and AP-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-03329
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-79413
Species: Hu
Applications: WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-52553
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP2-56413
Species: Hu
Applications: ICC/IF, IP, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1443
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-2244
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3994
Species: Hu
Applications: WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31101
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00057510-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-33381PEP
Species: Hu
Applications: AC

Publications for CRM1 Protein (NBP2-33381PEP) (0)

There are no publications for CRM1 Protein (NBP2-33381PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRM1 Protein (NBP2-33381PEP) (0)

There are no reviews for CRM1 Protein (NBP2-33381PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRM1 Protein (NBP2-33381PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRM1 Products

Research Areas for CRM1 Protein (NBP2-33381PEP)

Find related products by research area.

Blogs on CRM1.

Survivin Acetylation: Affecting Apoptosis and Cancer
Survivin (BRIC5) is an inhibitor of apoptosis that also promotes cellular adaptation under stressful conditions and helps to regulate cell division. Recently, an antibody study by Dr. H Wang et al. at Brown University [PMID: 20826784] found that Survi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol XPO1