CRM1 Antibody [mFluor Violet 500 SE] Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1 (NP_003391.1).
Sequence: PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
XPO1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for CRM1 Antibody [mFluor Violet 500 SE]
Background
Official Gene Symbol: XPO1 Gen Bank Accession Number: NP_003391 Gene ID: 7514 (human) Gene Map Locus: 2p16 (human) Nuclear transport receptors of karyopherin/importin-beta superfamily mediate various transport pathways between nucleus and cytoplasm. Exportin-1, a human homolog of yeast CRM1, is a novel karyopherin export receptor that mediates leucine-rich NES-dependent protein export. It interacts with RanGTP through its Ran-binding domain and also with nucleoporins including Nup214, Nup50, Nup42 and Nup159 during the process of exporting NES-containing proteins. It mediates the export of many cellular and viral proteins and ribonucleoproteins including HIV Rev Protein, ERK3, PKI, IRF-5, Cyclin-B, MAPKK, MAPKAP kinase 2, Snurportin, Cap-binding protein, and certain U snRNAs. Reports suggest exportin-1 also has a role in the regulation of NFAT and AP-1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Hu
Applications: WB
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu, Mu
Applications: WB, ELISA
Publications for CRM1 Antibody (NBP3-35072MFV500) (0)
There are no publications for CRM1 Antibody (NBP3-35072MFV500).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CRM1 Antibody (NBP3-35072MFV500) (0)
There are no reviews for CRM1 Antibody (NBP3-35072MFV500).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CRM1 Antibody (NBP3-35072MFV500) (0)