CrkL Antibody

Images

 
Western Blot: CrkL Antibody [NBP1-86181] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more
Immunohistochemistry-Paraffin: CrkL Antibody [NBP1-86181] - Staining of human fallopian tube shows membranous and cytoplasmic positivity in glandular cells.
Western Blot: CrkL Antibody [NBP1-86181] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-135

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CrkL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRKL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CrkL Protein (NBP1-86181PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CrkL Antibody

  • CrkL
  • crk-like protein
  • v-crk avian sarcoma virus CT10 oncogene homolog-like
  • v-crk sarcoma virus CT10 oncogene homolog (avian)-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-49154
Species: Hu
Applications: IHC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-45515
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86181
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CrkL Antibody (NBP1-86181) (0)

There are no publications for CrkL Antibody (NBP1-86181).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CrkL Antibody (NBP1-86181) (0)

There are no reviews for CrkL Antibody (NBP1-86181). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CrkL Antibody (NBP1-86181) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CrkL Products

Bioinformatics Tool for CrkL Antibody (NBP1-86181)

Discover related pathways, diseases and genes to CrkL Antibody (NBP1-86181). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CrkL Antibody (NBP1-86181)

Discover more about diseases related to CrkL Antibody (NBP1-86181).
 

Pathways for CrkL Antibody (NBP1-86181)

View related products by pathway.

PTMs for CrkL Antibody (NBP1-86181)

Learn more about PTMs related to CrkL Antibody (NBP1-86181).
 

Research Areas for CrkL Antibody (NBP1-86181)

Find related products by research area.

Blogs on CrkL

There are no specific blogs for CrkL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CrkL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRKL
Entrez