CREB3L3 Antibody

Images

 
Western Blot: CREB3L3 Antibody [NBP2-38785] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunohistochemistry-Paraffin: CREB3L3 Antibody [NBP2-38785] - Staining in human duodenum and pancreas tissues using anti-CREB3L3 antibody. Corresponding CREB3L3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CREB3L3 Antibody [NBP2-38785] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: CREB3L3 Antibody [NBP2-38785] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CREB3L3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLE
Specificity
Specificity of human CREB3L3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREB3L3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CREB3L3 Protein (NBP2-38785PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CREB3L3 Antibody

  • cAMP responsive element binding protein 3-like 3
  • cAMP-responsive element-binding protein 3-like protein 3
  • CREB/ATF family transcription factor
  • CREB-H
  • CREBHMGC126557
  • cyclic AMP-responsive element-binding protein 3-like protein 3
  • MGC126553
  • Transcription factor CREB-H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82503
Species: Hu
Applications: IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Po, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90205
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58307
Species: Hu
Applications: WB, ICC/IF
NB100-410
Species: Hu, Mu
Applications: WB, IP
AF4497
Species: Hu
Applications: WB, Simple Western
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88697
Species: Hu
Applications: WB, IHC, IHC-P
AF8125
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59337
Species: Hu, Bv
Applications: WB
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-89113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-38785
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CREB3L3 Antibody (NBP2-38785) (0)

There are no publications for CREB3L3 Antibody (NBP2-38785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREB3L3 Antibody (NBP2-38785) (0)

There are no reviews for CREB3L3 Antibody (NBP2-38785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CREB3L3 Antibody (NBP2-38785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CREB3L3 Antibody (NBP2-38785)

Discover related pathways, diseases and genes to CREB3L3 Antibody (NBP2-38785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB3L3 Antibody (NBP2-38785)

Discover more about diseases related to CREB3L3 Antibody (NBP2-38785).
 

Pathways for CREB3L3 Antibody (NBP2-38785)

View related products by pathway.

PTMs for CREB3L3 Antibody (NBP2-38785)

Learn more about PTMs related to CREB3L3 Antibody (NBP2-38785).

Blogs on CREB3L3

There are no specific blogs for CREB3L3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREB3L3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB3L3
Uniprot