Creatine Kinase BB Antibody (1G10U9)

Western Blot: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510] - Western blot analysis of extracts of various cell lines, using Creatine Kinase BB Rabbit mAb (NBP3-16510) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510] - Immunohistochemistry of paraffin-embedded human appendix using Creatine Kinase BB Rabbit mAb (NBP3-16510) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510] - Immunohistochemistry of paraffin-embedded rat heart using Creatine Kinase BB Rabbit mAb (NBP3-16510) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 1G10U9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Creatine Kinase BB Antibody (1G10U9) Summary

• Description: Novus Biologicals Rabbit Creatine Kinase BB Antibody (1G10U9) (NBP3-16510) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Creatine Kinase BB (NP_001814.2). MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGY
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CKB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Creatine Kinase BB Antibody (1G10U9)

• B-CK
• CKB
• Creatine Kinase BB
• Creatine Kinase Isoenzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKB