Western Blot: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of extracts of various cell lines, using Creatine kinase MT 1B antibody (NBP3-05655) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG ...read more
Immunoprecipitation: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of 600ug extracts of Mouse brain cells using 3ug CKMT1B antibody. Western blot was performed from the immunoprecipitate using CKMT1B antibody ...read more
Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody [NBP3-05655] - Immunofluorescence analysis of U-2 OS cells using Creatine kinase MT 1B Polyclonal Antibody (NBP3-05655) at dilution of 1:100 (40x ...read more
Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655] - Immunofluorescence analysis of NIH-3T3 cells using Creatine kinase MT 1B Rabbit pAb (A3046) at dilution of ...read more
Novus Biologicals Rabbit Creatine kinase MT 1B Antibody - Azide and BSA Free (NBP3-05655) is a polyclonal antibody validated for use in WB, ICC/IF and IP. Anti-Creatine kinase MT 1B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKMT1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Alternate Names for Creatine kinase MT 1B Antibody - Azide and BSA Free
Acidic-Type Mitochondrial Creatine Kinase
CKMT
CKMT1
CKMT1B
Creatine Kinase U-Type, Mitochondrial
Creatine Kinase, Mitochondrial 1 (Ubiquitous)
Creatine Kinase, Mitochondrial 1B
EC 2.7.3.2
Mia-CK
Ubiquitous Mitochondrial Creatine Kinase
UMTCK
U-MtCK
Background
Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Creatine kinase MT 1B Antibody (NBP3-05655)(1)
We have publications tested in 1 confirmed species: Mouse.
Reviews for Creatine kinase MT 1B Antibody (NBP3-05655) (0)
There are no reviews for Creatine kinase MT 1B Antibody (NBP3-05655).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Creatine kinase MT 1B Antibody - Azide and BSA Free and receive a gift card or discount.