Creatine kinase MT 1B Antibody - Azide and BSA Free

Images

 
Western Blot: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of extracts of various cell lines, using Creatine kinase MT 1B antibody (NBP3-05655) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG ...read more
Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody [NBP3-05655] - Immunofluorescence analysis of U-2 OS cells using Creatine kinase MT 1B Polyclonal Antibody (NBP3-05655) at dilution of 1:100 (40x ...read more
Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody [NBP3-05655] - Immunofluorescence analysis of NIH-3T3 cells using Creatine kinase MT 1B Polyclonal Antibody (NBP3-05655) at dilution of 1:100 (40x ...read more
Immunoprecipitation: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of 600ug extracts of Mouse brain cells using 3ug CKMT1B antibody. Western blot was performed from the immunoprecipitate using CKMT1B antibody ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Creatine kinase MT 1B Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKMT1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000
Publications
Read Publication using
NBP3-05655 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Creatine kinase MT 1B Antibody - Azide and BSA Free

  • Acidic-Type Mitochondrial Creatine Kinase
  • CKMT
  • CKMT1
  • CKMT1B
  • Creatine Kinase U-Type, Mitochondrial
  • Creatine Kinase, Mitochondrial 1 (Ubiquitous)
  • Creatine Kinase, Mitochondrial 1B
  • EC 2.7.3.2
  • Mia-CK
  • Ubiquitous Mitochondrial Creatine Kinase
  • UMTCK
  • U-MtCK

Background

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
NBP1-84460
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NBP2-13841
Species: Hu
Applications: IHC, IHC-P
DBD00
Species: Hu
Applications: ELISA
AF2009
Species: Hu
Applications: ICC, IHC
NBP2-98675
Species: Hu
Applications: IHC-P, IP, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1598
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-38895
Species: Hu
Applications: IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-85081
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB

Publications for Creatine kinase MT 1B Antibody (NBP3-05655)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Creatine kinase MT 1B Antibody (NBP3-05655) (0)

There are no reviews for Creatine kinase MT 1B Antibody (NBP3-05655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Creatine kinase MT 1B Antibody (NBP3-05655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Creatine kinase MT 1B Products

Diseases for Creatine kinase MT 1B Antibody (NBP3-05655)

Discover more about diseases related to Creatine kinase MT 1B Antibody (NBP3-05655).

Research Areas for Creatine kinase MT 1B Antibody (NBP3-05655)

Find related products by research area.

Blogs on Creatine kinase MT 1B

There are no specific blogs for Creatine kinase MT 1B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Creatine kinase MT 1B Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CKMT1B