CRB3 Antibody

Images

 
Western Blot: CRB3 Antibody [H00092359-B01P] - Analysis of CRB3 expression in transfected 293T cell line by CRB3 polyclonal antibody. Lane 1: CRB3 transfected lysate(13.2 KDa). Lane 2: Non-transfected lysate.
Western Blot: CRB3 Antibody [H00092359-B01P] - CRB3 MaxPab polyclonal antibody. Western Blot analysis of CRB3 expression in A-549.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRB3 Antibody Summary

Immunogen
CRB3 (NP_631900.1, 1 a.a. - 120 a.a.) full-length human protein. MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
Specificity
CRB3 - crumbs homolog 3 (Drosophila),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CRB3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRB3 Antibody

  • crumbs 3
  • crumbs homolog 3 (Drosophila)
  • crumbs protein homolog 3
  • MGC17303

Background

This gene encodes a member of the Crumbs family of proteins. This protein may play a role in epithelial cell polarity and is associated with tight junctions at the apical surface of epithelial cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRB3 Antibody (H00092359-B01P) (0)

There are no publications for CRB3 Antibody (H00092359-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRB3 Antibody (H00092359-B01P) (0)

There are no reviews for CRB3 Antibody (H00092359-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRB3 Antibody (H00092359-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRB3
Entrez
Uniprot