Novus Biologicals products are now on

CRB1 Antibody


Immunohistochemistry-Paraffin: CRB1 Antibody [NBP2-56113] - Staining of human retina shows cytoplasmic positivity in all layers of retina.
CRB1 Antibody [NBP2-56113] -Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
CRB1 Antibody [NBP2-56113] -Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
CRB1 Antibody [NBP2-56113] - Staining of human duodenum shows negative cytoplasmic positivity in glandular cells as expected.
CRB1 Antibody [NBP2-56113] -Staining of human placenta shows negative cytoplasmic positivity in trophoblastic cells as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC

Order Details

CRB1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLLALENSTYQYIRVWLERGRLAMLTPNSPKLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDV
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRB1 Recombinant Protein Antigen (NBP2-56113PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CRB1 Antibody

  • crumbs homolog 1 (Drosophila)
  • LCA8


CRB1, also known as Protein crumbs homolog 1, contains several isoforms that are 154 kDa, 151 kDa, 142 kDa, 104 kDa, and 95 kDa, and is involved in the development of photoreceptors in the retina. Defects and mutations in the CRB1 protein result in a variety of disorders, and more research is currently being conducted on the protein's relation to other diseases, including pigmented paravenous chorioretinal atrophy, cone-rod dystrophy, Stargardt disease, keratoconus, retinal degeneration, hyperopia, tuberous sclerosis, and blindness. The protein is linked to epithelial tight junction pathways, and interacts with INADL, MPP5, PSMD13, PRKAR1A, and DDX56.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, IF, PEP-ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC

Publications for CRB1 Antibody (NBP2-56113) (0)

There are no publications for CRB1 Antibody (NBP2-56113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRB1 Antibody (NBP2-56113) (0)

There are no reviews for CRB1 Antibody (NBP2-56113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRB1 Antibody (NBP2-56113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CRB1 Products

Array NBP2-56113

Research Areas for CRB1 Antibody (NBP2-56113)

Find related products by research area.

Blogs on CRB1

There are no specific blogs for CRB1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CRB1 Antibody and receive a gift card or discount.


Gene Symbol CRB1