![Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human eye, retina, liver, lymphoid tissues and squamous epithelia using Anti-RLBP1 antibody NBP2-58065 (A) shows similar protein distribution across tissues to independent antibody (B).](http://images.novusbio.com/fullsize/CRALBP-Antibody-Immunohistochemistry-Paraffin-NBP2-58065-img0004.jpg "Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human eye, retina, liver, lymphoid tissues and squamous epithelia using Anti-RLBP1 antibody NBP2-58065 (A) shows similar protein distribution across tissues to independent antibody (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CRALBP Antibody - BSA Free (NBP2-58065) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSD |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RLBP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, Retrieval method: HIER pH6. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CRALBP Antibody (NBP2-58065)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RLBP1 |
![Immunocytochemistry/Immunofluorescence: CRALBP Antibody [NBP2-58065] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm, cytosol & centrosome.](http://images.novusbio.com/fullsize/CRALBP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58065-img0001.jpg "Immunocytochemistry/Immunofluorescence: CRALBP Antibody [NBP2-58065] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm, cytosol & centrosome.")
![Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/CRALBP-Antibody-Immunohistochemistry-Paraffin-NBP2-58065-img0007.jpg "Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human retina shows strong positivity in pigment epithelium, Mueller glia and inner nuclear layer.](http://images.novusbio.com/fullsize/CRALBP-Antibody-Immunohistochemistry-Paraffin-NBP2-58065-img0002.jpg "Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human retina shows strong positivity in pigment epithelium, Mueller glia and inner nuclear layer.")
![Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/CRALBP-Antibody-Immunohistochemistry-Paraffin-NBP2-58065-img0005.jpg "Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human cervix shows no positivity in squmaous epithelial cells as expected.](http://images.novusbio.com/fullsize/CRALBP-Antibody-Immunohistochemistry-Paraffin-NBP2-58065-img0006.jpg "Immunohistochemistry-Paraffin: CRALBP Antibody [NBP2-58065] - Staining of human cervix shows no positivity in squmaous epithelial cells as expected.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")