CPSF6 Antibody - BSA Free

Western Blot: CPSF6 Antibody [NBP1-57541] - Jurkat cell lysate, Antibody Titration: 0.3125ug/ml

Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-57541] - SKOV3 Primary Antibody Dilution: 4 ug/ml Secondary Antibody : Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml

Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-57541] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

CPSF6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CPSF6 (cleavage and polyadenylation specific factor 6, 68kDa) The peptide sequence was selected from the middle region of CPSF6. Peptide sequence PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPSF6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for CPSF6 Antibody - BSA Free

• CFIM
• CFIm68
• CFIM68CPSF 68 kDa subunit
• CFIMcleavage and polyadenylation specific factor 6, 68kD subunit
• cleavage and polyadenylation specific factor 6, 68kDa
• Cleavage and polyadenylation specificity factor 68 kDa subunit
• cleavage and polyadenylation specificity factor subunit 6
• HPBRII-4
• HPBRII-7
• pre-mRNA cleavage factor I, 68kD subunit
• pre-mRNA cleavage factor Im (68kD)
• Pre-mRNA cleavage factor Im 68 kDa subunit
• Protein HPBRII-4/7

Background

CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPSF6