CPN1 Antibody


Western Blot: CPN1 Antibody [NBP1-57960] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: CPN1 Antibody [NBP1-57960] - Human Heart Tissue, antibody concentration 2.5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CPN1 Antibody Summary

Synthetic peptides corresponding to CPN1(carboxypeptidase N, polypeptide 1) The peptide sequence was selected from the middle region of CPN1. Peptide sequence FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CPN1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CPN1 Antibody

  • ACBP
  • Anaphylatoxin inactivator
  • Arginine carboxypeptidase
  • carboxypeptidase N polypeptide 1 50 kD
  • Carboxypeptidase N polypeptide 1
  • Carboxypeptidase N small subunit
  • carboxypeptidase N, polypeptide 1
  • carboxypeptidase N, polypeptide 1, 50kD
  • CPNcarboxypeptidase N catalytic chain
  • EC 3.4.17
  • EC
  • FLJ40792
  • kininase I
  • kininase-1
  • Lysine carboxypeptidase
  • Plasma carboxypeptidase B
  • SCPNcarboxypeptidase N catalytic subunit
  • Serum carboxypeptidase N


Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits; this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency.Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits; this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, Neut
Species: Hu, Ba
Applications: WB, ELISA
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for CPN1 Antibody (NBP1-57960) (0)

There are no publications for CPN1 Antibody (NBP1-57960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPN1 Antibody (NBP1-57960) (0)

There are no reviews for CPN1 Antibody (NBP1-57960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPN1 Antibody (NBP1-57960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CPN1 Antibody (NBP1-57960)

Discover related pathways, diseases and genes to CPN1 Antibody (NBP1-57960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPN1 Antibody (NBP1-57960)

Discover more about diseases related to CPN1 Antibody (NBP1-57960).

Pathways for CPN1 Antibody (NBP1-57960)

View related products by pathway.

PTMs for CPN1 Antibody (NBP1-57960)

Learn more about PTMs related to CPN1 Antibody (NBP1-57960).

Blogs on CPN1

There are no specific blogs for CPN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CPN1 Antibody and receive a gift card or discount.


Gene Symbol CPN1