Carboxypeptidase M Antibody

Images

 
Western Blot: Carboxypeptidase M Antibody [NBP1-87403] - Analysis in human cell line SiHa.
Immunohistochemistry-Paraffin: Carboxypeptidase M Antibody [NBP1-87403] - Staining of human endometrium shows distinct luminal membranous positivity in glandular cells.
Western Blot: Carboxypeptidase M Antibody [NBP1-87403] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carboxypeptidase M Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
Carboxypeptidase M Protein (NBP1-87403PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carboxypeptidase M Antibody

  • Carboxypeptidase M
  • CPM
  • EC 3.4.17
  • EC 3.4.17.12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6108
Species: Hu
Applications: IHC
AF1396
Species: Hu
Applications: WB
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Carboxypeptidase M Antibody (NBP1-87403) (0)

There are no publications for Carboxypeptidase M Antibody (NBP1-87403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxypeptidase M Antibody (NBP1-87403) (0)

There are no reviews for Carboxypeptidase M Antibody (NBP1-87403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carboxypeptidase M Antibody (NBP1-87403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carboxypeptidase M Products

Bioinformatics Tool for Carboxypeptidase M Antibody (NBP1-87403)

Discover related pathways, diseases and genes to Carboxypeptidase M Antibody (NBP1-87403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxypeptidase M Antibody (NBP1-87403)

Discover more about diseases related to Carboxypeptidase M Antibody (NBP1-87403).
 

Pathways for Carboxypeptidase M Antibody (NBP1-87403)

View related products by pathway.

PTMs for Carboxypeptidase M Antibody (NBP1-87403)

Learn more about PTMs related to Carboxypeptidase M Antibody (NBP1-87403).

Blogs on Carboxypeptidase M

There are no specific blogs for Carboxypeptidase M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carboxypeptidase M Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPM
Entrez