Carboxypeptidase M Antibody

Images

 
Western Blot: Carboxypeptidase M Antibody [NBP1-87403] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: Carboxypeptidase M Antibody [NBP1-87403] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Carboxypeptidase M Antibody [NBP1-87403] - Staining of human endometrium shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: Carboxypeptidase M Antibody [NBP1-87403] - Staining of human kidney shows weak membranous/ secretion positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Carboxypeptidase M Antibody [NBP1-87403] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carboxypeptidase M Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVS
Specificity
Specificity of human Carboxypeptidase M antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carboxypeptidase M Protein (NBP1-87403PEP)
Publications
Read Publication using
NBP1-87403 in the following applications:

  • KD
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carboxypeptidase M Antibody

  • Carboxypeptidase M
  • CPM
  • EC 3.4.17
  • EC 3.4.17.12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-78736
Species: Hu
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NLS799
Species: Hu
Applications: WB, IHC, IHC-P
NB100-214
Species: Hu, Mu
Applications: WB, IP
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF

Publications for Carboxypeptidase M Antibody (NBP1-87403)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: KD, WB.


Filter By Application
KD
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Carboxypeptidase M Antibody (NBP1-87403) (0)

There are no reviews for Carboxypeptidase M Antibody (NBP1-87403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carboxypeptidase M Antibody (NBP1-87403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Carboxypeptidase M Products

Bioinformatics Tool for Carboxypeptidase M Antibody (NBP1-87403)

Discover related pathways, diseases and genes to Carboxypeptidase M Antibody (NBP1-87403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxypeptidase M Antibody (NBP1-87403)

Discover more about diseases related to Carboxypeptidase M Antibody (NBP1-87403).
 

Pathways for Carboxypeptidase M Antibody (NBP1-87403)

View related products by pathway.

PTMs for Carboxypeptidase M Antibody (NBP1-87403)

Learn more about PTMs related to Carboxypeptidase M Antibody (NBP1-87403).

Blogs on Carboxypeptidase M

There are no specific blogs for Carboxypeptidase M, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carboxypeptidase M Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPM