COX11 Antibody

Images

 
Immunohistochemistry-Paraffin: COX11 Antibody [NBP2-13863] Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COX11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDP EFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COX11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COX11 Protein (NBP2-13863PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX11 Antibody

  • COX11 (yeast) homolog, cytochrome c oxidase assembly protein
  • COX11 cytochrome c oxidase assembly homolog (yeast)
  • COX11 homolog, cytochrome c oxidase assembly protein
  • COX11P
  • cytochrome c oxidase assembly protein COX11, mitochondrial
  • cytochrome c oxidase subunit 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77273
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-30388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77274
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86676
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59560
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74048
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89663
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13863
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for COX11 Antibody (NBP2-13863) (0)

There are no publications for COX11 Antibody (NBP2-13863).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX11 Antibody (NBP2-13863) (0)

There are no reviews for COX11 Antibody (NBP2-13863). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COX11 Antibody (NBP2-13863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX11 Products

Bioinformatics Tool for COX11 Antibody (NBP2-13863)

Discover related pathways, diseases and genes to COX11 Antibody (NBP2-13863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX11 Antibody (NBP2-13863)

Discover more about diseases related to COX11 Antibody (NBP2-13863).
 

Pathways for COX11 Antibody (NBP2-13863)

View related products by pathway.

PTMs for COX11 Antibody (NBP2-13863)

Learn more about PTMs related to COX11 Antibody (NBP2-13863).

Blogs on COX11

There are no specific blogs for COX11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX11