COX-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COX-2 Antibody [NBP1-85499] - Staining of human cell line A549 shows localization to endoplasmic reticulum.
Immunohistochemistry: COX-2 Antibody [NBP1-85499] - Staining in human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COX-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COX-2 Protein (NBP1-85499PEP)
Publications
Read Publications using
NBP1-85499 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%). Human reactivity reported in scientific literature (PMID: 23090667).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX-2 Antibody

  • COX2
  • COX-2
  • COX2cyclooxygenase 2b
  • cyclooxygenase-2
  • EC 1.14.99
  • EC 1.14.99.1
  • GRIPGHS
  • hCox-2
  • PGG/HS
  • PGH synthase 2
  • PGHS-2
  • PHS II
  • PHS-2
  • PHS-II
  • prostaglandin G/H synthase 2
  • prostaglandin G/H synthase and cyclooxygenase
  • Prostaglandin H2 synthase 2
  • prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase andcyclooxygenase)
  • Prostaglandin-endoperoxide synthase 2
  • PTGS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for COX-2 Antibody (NBP1-85499)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for COX-2 Antibody (NBP1-85499) (0)

There are no reviews for COX-2 Antibody (NBP1-85499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COX-2 Antibody (NBP1-85499). (Showing 1 - 1 of 1 FAQs).

  1. I am a student researching COX-2 expression in felines and am looking for a suitable primary antibody to use in IHC. To your knowledge, have any of your COX-2 antibodies been used successfully with feline COX-2? If yes, I would be very interested in learning more. If not, would it be possible to run a sequence homology of feline COX-2 (GenBank ABM65700.1, accession EF036473.1) against your available COX-2 antibodies to determine the overlap and likelihood of cross-reactivity?
    • We have not tested any of these antibodies for their reactivity in felines. However, we do have a number of antibodies that look like they may cross-react with feline. NBP1-85499 recognizes a region that is about 90-91% similar to feline COX2. NBP2-04015 recognizes a region in humans that is 94% similar to feline COX2. NB100-868 recognizes a region in humans at the far C-terminal 12 amino acids that is 100% identical to feline COX2. NBP1-19354 recognizes a region that is also about 95% similar to feline COX2. Only NBP1-85499 and NBP1-19354 have been tested for use in IHC. If you would like to test this antibody in an untested species and/or application and share your results with us, then I can recommend our Innovators Reward Program.

Secondary Antibodies

 

Isotype Controls

Additional COX-2 Products

Bioinformatics Tool for COX-2 Antibody (NBP1-85499)

Discover related pathways, diseases and genes to COX-2 Antibody (NBP1-85499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX-2 Antibody (NBP1-85499)

Discover more about diseases related to COX-2 Antibody (NBP1-85499).
 

Pathways for COX-2 Antibody (NBP1-85499)

View related products by pathway.

PTMs for COX-2 Antibody (NBP1-85499)

Learn more about PTMs related to COX-2 Antibody (NBP1-85499).
 

Research Areas for COX-2 Antibody (NBP1-85499)

Find related products by research area.

Blogs on COX-2.

SUCNR1/GPR91 - a potential role in renovascular hypertension
SUCNR1 is the cognate receptor for the Kreb's citric acid cycle intermediate succinate. It is of interest to scientists because it is involved in not only energy metabolism but possibly also in renovascular hypertension, a condition linked to diabe...  Read full blog post.

Inhibitor kappa B-alpha (IkappaB-alpha)
The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGS2
Entrez