CORO2A Antibody - BSA Free

Western Blot: CORO2A Antibody [NBP1-81583] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)

Immunocytochemistry/Immunofluorescence: CORO2A Antibody [NBP1-81583] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: CORO2A Antibody [NBP1-81583] - Staining of human testis.

Immunohistochemistry-Paraffin: CORO2A Antibody [NBP1-81583] - Staining of human kidney shows low expression as expected.

Immunohistochemistry-Paraffin: CORO2A Antibody [NBP1-81583] - Staining in human small intestine and kidney tissues using anti-CORO2A antibody. Corresponding CORO2A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CORO2A Antibody [NBP1-81583] - Staining of human kidney, lymph node, small intestine and testis using Anti-CORO2A antibody NBP1-81583 (A) shows similar protein distribution across tissues to independent antibody NBP1-81582 (B).

Immunohistochemistry-Paraffin: CORO2A Antibody [NBP1-81583] - Staining of human lymph node.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CORO2A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CORO2A Antibody - BSA Free (NBP1-81583) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CORO2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CORO2A Protein (NBP1-81583PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CORO2A Antibody - BSA Free

• CLIPINB
• coronin, actin binding protein, 2A
• coronin, actin-binding protein, 2A
• coronin-like protein B
• DKFZp686G19226
• IR10coronin 2A
• WD protein IR10
• WD repeat-containing protein 2
• WDR2coronin-2A
• WD-repeat protein 2

Background

The CORO2A gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric ormultiprotein compl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CORO2A