Coronin-2B Antibody

Immunocytochemistry/Immunofluorescence: Coronin-2B Antibody [NBP1-85567] - Staining of human cell line U-251 MG shows localization to plasma membrane & focal adhesion sites. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Coronin-2B Antibody [NBP1-85567] - Staining of human fallopian tube shows weak membranous/cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Coronin-2B Antibody [NBP1-85567] - Analysis in human cerebral cortex and liver tissues. Corresponding CORO2B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Coronin-2B Antibody [NBP1-85567] - Staining of human cerebellum shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: Coronin-2B Antibody [NBP1-85567] - Staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: Coronin-2B Antibody [NBP1-85567] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Coronin-2B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQ
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CORO2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Coronin-2B Protein (NBP1-85567PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Coronin-2B Antibody

• clipin C
• CLIPINC
• Clipin-C
• coronin, actin binding protein, 2B
• coronin, actin-binding protein, 2B
• coronin, actin-binding, 2B
• coronin-2B
• Coronin-like protein C
• KIAA0925clipin-C
• Protein FC96

Background

Research results indicate that ClipinC is a component part of the cross bridge between the actin cytoskeleton and the plasma membrane. These findings and the previously reported function of coronin suggest that ClipinC may play specific roles in the reorganization of neuronal actin structure, a change that has been implicated in both cell motility and growth cone advance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Coronin-2B Antibody (NBP1-85567)(1)

Publication using NBP1-85567

• Zhou R, Han B, Nowak R et al. Proteomic and functional analyses of the periodic membrane skeleton in neurons Nature communications 2022-06-09 [PMID: 35680881] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: CORO2B