COMT Antibody (1G4-1A1)

Images

 
Western Blot: COMT Antibody (1G4-1A1) [H00001312-M01] - COMT monoclonal antibody (M01), clone 1G4-1A1 Analysis of COMT expression in A-431.
Western Blot: COMT Antibody (1G4-1A1) [H00001312-M01] - Analysis of COMT expression in transfected 293T cell line by COMT monoclonal antibody (M01), clone 1G4-1A1.Lane 1: COMT transfected lysate(24.4 KDa).Lane 2: ...read more
Sandwich ELISA: COMT Antibody (1G4-1A1) [H00001312-M01] - Detection limit for recombinant GST tagged COMT is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G4-1A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COMT Antibody (1G4-1A1) Summary

Immunogen
COMT (AAH00419.2, 1 a.a. - 182 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Specificity
COMT (1G4-1A1)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COMT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.
Positive Control
COMT Lysate (NBP2-65831)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COMT Antibody (1G4-1A1)

  • catechol O-methyltransferase
  • catechol-O-methyltransferase
  • COMT
  • EC 2.1.1.6

Background

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. The transcript variants are formed through the use of alternative translation initiation sites and promoters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NLS3921
Species: Hu, Mk, Pm
Applications: IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
H00001813-M01A
Species: Hu
Applications: WB, ELISA
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
H00001312-M01
Species: Hu
Applications: WB, ELISA

Publications for COMT Antibody (H00001312-M01) (0)

There are no publications for COMT Antibody (H00001312-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COMT Antibody (H00001312-M01) (0)

There are no reviews for COMT Antibody (H00001312-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COMT Antibody (H00001312-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for COMT Antibody (H00001312-M01)

Discover related pathways, diseases and genes to COMT Antibody (H00001312-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COMT Antibody (H00001312-M01)

Discover more about diseases related to COMT Antibody (H00001312-M01).
 

Pathways for COMT Antibody (H00001312-M01)

View related products by pathway.

PTMs for COMT Antibody (H00001312-M01)

Learn more about PTMs related to COMT Antibody (H00001312-M01).
 

Research Areas for COMT Antibody (H00001312-M01)

Find related products by research area.

Blogs on COMT

There are no specific blogs for COMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COMT Antibody (1G4-1A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol COMT
Entrez
OMIM
Uniprot