Complement Factor H-related 1/CFHR1/CFHL1 Antibody

Images

 
Immunohistochemistry: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14475] - Staining of human lung shows distinct positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement Factor H-related 1/CFHR1/CFHL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFHR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14475PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement Factor H-related 1/CFHR1/CFHL1 Antibody

  • BTA
  • CFHL1FHR-1
  • CFHLCFHR1P
  • CFHR1
  • complement factor H-related 1 pseudogene
  • Complement Factor Hrelated 1
  • Complement Factor H-related 1
  • complement factor H-related protein 1
  • FHR1
  • FHR1CFHL1P
  • H factor (complement)-like 1
  • H factor (complement)-like 2
  • H factor-like protein 1
  • H36-1
  • H36-2
  • H-factor-like 1
  • HFL1H36
  • HFL2
  • MGC104329

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4779
Species: Hu
Applications: WB, IHC
NBP2-02654
Species: Hu, Rt
Applications: WB, Flow, ICC/IF
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-52440
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
MAB5980
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
MAB5484
Species: Hu
Applications: WB, IP
AF1936
Species: Hu
Applications: WB, IP
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14475
Species: Hu
Applications: IHC, IHC-P

Publications for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475) (0)

There are no publications for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475) (0)

There are no reviews for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor H-related 1/CFHR1/CFHL1 Products

Bioinformatics Tool for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475)

Discover related pathways, diseases and genes to Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475)

Discover more about diseases related to Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475).
 

Pathways for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475)

View related products by pathway.

PTMs for Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475)

Learn more about PTMs related to Complement Factor H-related 1/CFHR1/CFHL1 Antibody (NBP2-14475).

Blogs on Complement Factor H-related 1/CFHR1/CFHL1

There are no specific blogs for Complement Factor H-related 1/CFHR1/CFHL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor H-related 1/CFHR1/CFHL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFHR1
Entrez