Complement C5 Recombinant Protein Antigen

Images

 
There are currently no images for Complement C5 Protein (NBP1-84395PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Complement C5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C5.

Source: E. coli

Amino Acid Sequence: LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84395.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Complement C5 Recombinant Protein Antigen

  • anaphylatoxin C5a analog
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
  • C5
  • complement C5
  • complement component 5
  • CPAMD4MGC142298
  • FLJ17816
  • FLJ17822

Background

C5 is synthesised in the liver as a single polypeptide chain. Before secretion the molecule is glycosylated and secreted into plasma as a 190kDa glycoprotein consisting of a disulphide linked alpha-chain (115kDa) and beta-chain (75kDa). C5 occurs in plasma at about 75mg/L. It is activated via either the classical or the alternative complement pathway, by protoelytic cleavage of C5a (11.5kDa) from the N-terminal of the alpha-chain. C5a is a potent anaphylotoxin and stimulates directed migration of neutrophils, eosinophils, basophils and monocytes. The other fragment, C5b,initiates the assembly of the membrane attack complex that mediates the cytolysis of viral and bacterial pathogens.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-91803
Species: Hu
Applications: IHC,  IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB3648
Species: Hu
Applications: CyTOF-ready, Flow, Neut
AF1936
Species: Hu
Applications: IP, WB
H00000730-D01P
Species: Hu, Mu
Applications: WB
DIP100
Species: Hu
Applications: ELISA
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-15952
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP3-12295
Species: Hu, Pm, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP3-16514
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84395PEP
Species: Hu
Applications: AC

Publications for Complement C5 Protein (NBP1-84395PEP) (0)

There are no publications for Complement C5 Protein (NBP1-84395PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C5 Protein (NBP1-84395PEP) (0)

There are no reviews for Complement C5 Protein (NBP1-84395PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Complement C5 Protein (NBP1-84395PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement C5 Products

Research Areas for Complement C5 Protein (NBP1-84395PEP)

Find related products by research area.

Blogs on Complement C5.

Complement C3 - The Most Important Protein in the Complement System
The complement system is made up of a collection of proteins found in the bloodstream and is comprised of nine major complement proteins; complement C3 is one of them. The complement system is a crucial component of the cellular immune system becau...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Complement C5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C5